DPCstruct | MC2736
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 140 ± 8 aa |
| Standard deviation of domain lengths | 7.90 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0118 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832YWW0 | 53-197 | EDPIKINRIFEYRKGIEFSLGEERIKTPYASRFIVASRPDSFRIEIREDLRDKLPEIGEMVDCAILSGYQGIKEKYSDGKDDLYYIE… |
| A0A6L2PTS8 | 173-313 | VKVVGRDVKKDDIHLILEYKADEEWGIYRSPRANRFIVHNDDNNPLVSSLEEFDKLLEEFNPNLLVIGGLQMMDNYPYPKGVREQRL… |
| A0A7Z0A5D8 | 1-120 | None |
| K7FGP5 | 71-206 | None |
| A0A482X1S8 | 91-228 | None |
| A0A6N7V3Z9 | 51-194 | None |
| A0A0B1RU91 | 66-206 | None |
| A0A3S2PNH9 | 385-521 | None |
| A0A7K3ZUL3 | 29-180 | None |
| A0A3N2BD42 | 125-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.