DPCstruct | MC27357
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 179 ± 26 aa |
| Standard deviation of domain lengths | 25.63 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.52 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF20406- CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L9KLL8 | 1-169 | MDEENMTKSEEQQPLSLQKALQQCELVQNMIDLSISNLEGLRTKCATSNDLTQKEIRTLESKLVKYFSRQLSCKKKVALQERNAELD… |
| A0A6J1RKR6 | 58-226 | ESVRRTLDVAQTMINFTADQLDDLRTQCSVTAELTQQEIRMLEGKLIKLYCKQLVAKARLANPLPSDIIEYPSLQQWLRVVGLTQES… |
| A0A7D9E2A3 | 12-166 | None |
| A0A3S0ZUS2 | 12-211 | None |
| A0A3B4UZ29 | 15-198 | None |
| A0A835GTS8 | 25-194 | None |
| A0A4Z2BA91 | 15-209 | None |
| A0A1A6HTI6 | 1-215 | None |
| A0A833SBY9 | 15-227 | None |
| A0A2P8YI48 | 192-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.