DPCstruct | MC2735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 114 ± 10 aa |
| Standard deviation of domain lengths | 10.09 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A840FUZ6 | 7-122 | DQPGQPRQYTGVSVDKTCWWCDQYTGTVEALVTAGIITLDQLPGQPGGPKVAATYYAGVLRPPKGHTPKDEHYLNITRPKNCRTIKV… |
| A0A244EAY4 | 1-91 | MNVRAGLSFEQRADRDAYVGLPEALLAAGVLRPWQLPGAPGNGTTAVTFHADGTRARRGDPRSLLGECGRLQVRRVAKGCLRVEIWR… |
| A0A2R3QA18 | 2-116 | None |
| A0A328ZYL8 | 2-131 | None |
| A0A8B6LN04 | 34-135 | None |
| A0A2W5IL16 | 5-121 | None |
| A0A2W5KWU7 | 3-114 | None |
| A0A1F4EP80 | 5-118 | None |
| A0A1D2ULD2 | 11-126 | None |
| A0A1J5R7X2 | 89-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.