DPCstruct | MC27349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 127 ± 11 aa |
| Standard deviation of domain lengths | 10.87 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2ZA88 | 83-201 | FSYATLSKALNVSPDYKPTLKFYIQVDSSHGAYYIYKILKVDMNRQYNSKLKTFTGNIYYNLETNTKIYYSINGDFYNEGTISTTGG… |
| R6N736 | 27-157 | SDTSSKCHRILNIPLDVTATYKPQLELYCETSESGHYWGLSNIYLVNMEKNHDGSSKQFSGDVDMWFRNGYELEYIVNGDFYNNGTM… |
| A0A4R5YXU5 | 1-123 | None |
| W7DQS5 | 3-106 | None |
| A0A3Q8S3V5 | 87-222 | None |
| A0A1X1KCC6 | 51-185 | None |
| A0A177XKM0 | 2-137 | None |
| K0AX30 | 103-236 | None |
| A0A4V3J4I8 | 5-117 | None |
| A0A1F0N735 | 40-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.