DPCstruct | MC27335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 65 ± 10 aa |
| Standard deviation of domain lengths | 10.33 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.98 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | PF19264- CL0737 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H2UUP0 | 5-82 | IPLRVQFKRMKAAEWARSVVILLESEIGFETDTGFARAGDGHNRFSDLGYISPLDYNLLTNKPNIDGLATKVETAQKL |
| A0A6M4G0L0 | 1-62 | MPTVRYQLRGDTAANWAAVNPVLKAKEPGLETDTLLVKYGDGATDWNSLPYSAVNLPTILEA |
| A0A7K0H724 | 1-50 | None |
| A0A843GFP1 | 4-134 | None |
| A0A2X4N6M2 | 6-66 | None |
| A0A246E7R1 | 1-68 | None |
| A0A7X5U5N4 | 3-58 | None |
| A0A7D5S088 | 1-61 | None |
| A0A139PKK5 | 4-62 | None |
| A0A143XZP6 | 267-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.