DPCstruct | MC27334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 82 ± 13 aa |
| Standard deviation of domain lengths | 13.31 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A0A514 | 1-69 | MPYNEHTRIRDLLNDPRAVAVLERHVPGATSHPQLPEALDMTLREVSFYPESGLTPAKLQALVQDLAQL |
| A0A1R3VUE3 | 1-72 | MAGRFDLETTTLAQLLADPEAKAVIDDVVPELPHHPMIGFVKNMPLDQLLKMAGGQVPADTVAELTQRIGAL |
| A0A2N3BLS0 | 231-312 | None |
| A0A5S9NKB6 | 1-93 | None |
| A0A2W5NCQ4 | 293-364 | None |
| A0A438NE70 | 54-148 | None |
| A0A2P4ZXB5 | 528-601 | None |
| A0A368VSR6 | 321-390 | None |
| A0A4Z0M1X7 | 13-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.