DPCstruct | MC2733
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 122 ± 12 aa |
| Standard deviation of domain lengths | 11.92 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A809PV38 | 9-134 | YRFPTRAAIDALAIRFNLPNEKNMQDWEYEVADANRIDEFLVVYDSGELSEDEKFTLMAMLVQSSCDAIDRKENFLRSESWKQFLDL… |
| A0A249SU50 | 61-186 | MELKGRYVTKAAVTFLANKLNYPSEDWMQDWEYLVAEYKDISRYFELYAAEADDNIRFTLMEMMIETSNRGWDADWITEIWPKVKQM… |
| A0A7T9E5F9 | 18-138 | None |
| A0A222F610 | 172-316 | None |
| A0A4S3ZSD8 | 1-119 | None |
| A0A0Q5V9S1 | 4-123 | None |
| A0A1I6QR56 | 8-107 | None |
| A0A350H4R7 | 1-124 | None |
| A0A496W694 | 17-127 | None |
| A0A1B9JGT1 | 3-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.