DPCstruct | MC27325
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 77 ± 8 aa |
| Standard deviation of domain lengths | 7.69 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 54.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17760 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A075FY99 | 7-75 | VDSIDGLSPAISIQQKTTSKNPRSTVGTTTEIYDYLRLLFARIGIPHCTNCGRKISSQSIESITDSVIK |
| A0A7C0YQX1 | 16-87 | SKPDVDKIENLSPPVSIDQKSISRSPRSTAGTLTEVYDYLRILFAKIGVPHCYNCGNVMRKRNNSEILEGIL |
| A0A6N3UBV8 | 67-140 | None |
| A0A3D2QES1 | 69-141 | None |
| A0A3B0PMU9 | 1-76 | None |
| A0A377LQJ6 | 68-140 | None |
| T0E8R4 | 1-76 | None |
| M6GF69 | 68-140 | None |
| A0A1W9V4G7 | 26-107 | None |
| A0A3D3XTX0 | 70-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.