DPCstruct | MC27322
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 71 ± 6 aa |
| Standard deviation of domain lengths | 6.43 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 73.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P9PML4 | 1-71 | MDPVQRLFLDSIREYSTNSQAAGGLVDADSQYQKVLEEETAKLRRLYGGGDLTSFPNFKFREPQWDEVSQK |
| A0A4W5R729 | 267-337 | LDPIQKLFLDSIREYSSKSVASGGLVDAGPAYEKNLAEELTKLQRLYGGGDLTAFPEFKFTEPKLEEVAPK |
| A0A673GG86 | 32-102 | None |
| A0A3Q3XGJ1 | 1-71 | None |
| A0A672PKK8 | 39-101 | None |
| A0A2I4D6T2 | 452-532 | None |
| A0A2U9C7Y4 | 39-109 | None |
| A0A671PYM2 | 166-236 | None |
| A0A3P8UF06 | 373-452 | None |
| A0A671M775 | 45-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.