DPCstruct | MC2732
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 206 ± 25 aa |
| Standard deviation of domain lengths | 25.10 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.21 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 22.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A249SQG3 | 3-199 | KGKDIVDELNALSAGANWPARQPAYQVPPGYFDQFPGRMLELIHNDDNISVGDELRTISPTVAALPRHTPHSLPEGYFETLQPVLPN… |
| A0A1T5EV89 | 11-232 | GASGTLPEALRVNPYVLPEGYFEDLQQRILYRCRHIDDPQPGFVVPEGYFEQLGDSMMAKFAEQKLKDMVDEAGFSAPPAYFADLTE… |
| A0A7D5SBX6 | 1-180 | None |
| A0A291QT99 | 1-201 | None |
| A0A7G5XHZ8 | 1-256 | None |
| A0A7G9BIR2 | 18-221 | None |
| A0A2D8G1D6 | 1-162 | None |
| A0A3E1P4G0 | 123-361 | None |
| A0A537IL30 | 9-224 | None |
| A0A6B9ZKM7 | 91-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.