DPCstruct | MC27319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 79 ± 3 aa |
| Standard deviation of domain lengths | 3.18 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 91.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 40.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2TA25 | 6-82 | KDVVVSIDTPIAHGYKFLPKGDPYKTLNCRKKARAEGHIVYVVHNPKHQEIGIRVPAAIHDRVQEKSEQTQQSGAKA |
| G3JEJ0 | 7-83 | TVSPSAPMPKGYKLLRKGYAFMTALCRRKTTEAGKTLYVVRAGSRILGLRAPRHIINEVYEEERQTRATRRAVVTAR |
| A0A6A6Z6A4 | 1-83 | None |
| A0A2H4SLE1 | 7-83 | None |
| A0A6A6U458 | 1-79 | None |
| A0A545V7X6 | 6-81 | None |
| A0A168BWB4 | 7-83 | None |
| L7I7V2 | 11-90 | None |
| A0A6A5RME5 | 1-87 | None |
| A0A2P5HW28 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.