DPCstruct | MC27318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 162 ± 18 aa |
| Standard deviation of domain lengths | 18.25 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 44.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A167SSA9 | 4-163 | HTVLIAAIAALAEARFGQEGLVQATIQGLSNFGNPGQAATLAGQTPGVLLAGANACAKLALADQIVTELGDDPEVLAGAAALVGAEK… |
| A0A0L0H850 | 28-177 | GQQNPPVEGKIGQLQALKNGLAGTLSGQVPSTLLGAADPCAKLQLADTIVQAAPGDAATLAAARELVNAEQNFNPANNGKPKFCGNP… |
| A0A0L0SQX6 | 25-234 | None |
| A0A6G1GHI0 | 15-189 | None |
| A0A395IKC6 | 1-152 | None |
| A0A3M7M7V3 | 13-162 | None |
| A0A6P8BIQ1 | 2-165 | None |
| S3BUJ8 | 3-145 | None |
| E5A4Q0 | 5-169 | None |
| A0A3M2RJ64 | 2-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.