DPCstruct | MC27314
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 174 ± 19 aa |
| Standard deviation of domain lengths | 18.61 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 67.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C4K8E0 | 74-287 | DDGSTVKAGAFTMNAGHHRDGAECETAACQYDDTRTVAGIVTVGMNARGMWFSGAAAPWLAEWDRTVFQACQPSYHMRQGGGGAWQL… |
| A0A4V2JI17 | 275-442 | TSEGLVDVGLITMGTGHAGLGLNRQAAAEHYDHTGTMAAVVRAGEDSRGIWLAGAVLPDLSDEQRLRLSLSRFSGDWRQEGGGLELV… |
| A0A1F2WG73 | 569-733 | None |
| A0A3N5UY76 | 1-192 | None |
| A0A0D8HW23 | 440-609 | None |
| A0A4Q4DIQ2 | 423-583 | None |
| A0A2S0KJN7 | 83-252 | None |
| A0A7K3G5X5 | 215-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.