DPCstruct | MC27312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 113 ± 12 aa |
| Standard deviation of domain lengths | 11.71 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V1BNZ0 | 215-320 | FRPKSFLVTKEDKIMSTRQTEFASLAPKEQKKQDEWAQKKIKEMKSCPEQYDWLRRDENGWGGYICADGRHGMPDILIAEGDGAIII… |
| A0A2J6T416 | 14-125 | VAPFTAKSVLQTPDDFKFASRQTQRGSLAPRDLKEQDDWAQRMIKLVGVCPENNDWARKENPGGFQCLGGGHSMTDELLAEGLGGIL… |
| A0A194X1B6 | 20-140 | None |
| S3DWW7 | 131-261 | None |
| A0A1L7WES6 | 77-201 | None |
| A0A1L7WCG5 | 433-560 | None |
| G2YYR2 | 208-341 | None |
| H0EJY1 | 5-121 | None |
| A0A4Q4X2A1 | 204-298 | None |
| A0A370U1H2 | 88-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.