DPCstruct | MC27311
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 163 ± 15 aa |
| Standard deviation of domain lengths | 14.99 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6T239 | 1-147 | MTSENLSPVKPRYTRPEHSRVFCAQCDIHTEGFRGEHELRKRVDREHPNPVTKWVCIESTKPGHPIPVLPFSKCKACLQQKQYGPYY… |
| A0A3N4M304 | 3-174 | SHRSYVRRPHPRAYCDQCNEVRDGFRGDHELRRHKERVHAVNKKVWVTKDISPEGDFLAGCKACKRGKHYFADYNAAAHLRRQHFCK… |
| G0RYW5 | 267-451 | None |
| A0A5J5EBZ9 | 49-200 | None |
| A0A178DWU9 | 3-147 | None |
| A0A553HP42 | 122-282 | None |
| A0A063C7U9 | 238-388 | None |
| A0A364LBA6 | 210-381 | None |
| A0A7C8MQS6 | 287-472 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.