DPCstruct | MC27310
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 405 ± 46 aa |
| Standard deviation of domain lengths | 46.00 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A167VT43 | 35-357 | HEVVCAWPVSGQYGPGTRVLYYVLIAACVVARKVEWIRNACLAAVLLFPAIAALHGIVLAAVHVDGAVDMDIYGAFQLCAIGILTAP… |
| A0A2J6T0L0 | 4-406 | FVVFNDVECVFSLSGQYGRAPRVLYYGLILFVVGFRRQDWLTAGAAAACLIYGGTTAIHALLLAPSLALAKSSVADGIVTRTNGSNI… |
| A0A1L7XR66 | 14-380 | None |
| A0A178ES13 | 696-1089 | None |
| A0A6G1HIH3 | 87-505 | None |
| A0A6A6Z3X5 | 57-468 | None |
| A0A0D2G2S8 | 18-394 | None |
| A0A7H8QXV4 | 8-476 | None |
| A0A178ZZZ3 | 6-485 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.