DPCstruct | MC2731
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 481 ± 54 aa |
| Standard deviation of domain lengths | 54.10 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7ZFH6 | 1-348 | MSAWVKSLDTLANIIAPVNIHLNIQPIGVMKIDEWLYTSWYRGRKKLPDISILDRSKNEFDWPSYRGARPGDRSSWYWRWTFEELRD… |
| A0A0J1KDL7 | 1-455 | MIIEENGYISFVLPILNQWFAAKSLSENMININHIIEKGTLDYWKYPLIILITIFKEDTIDNILREIVEKVPGFASVLIEESIKKWG… |
| A0A3E2XP84 | 292-809 | None |
| A0A1Q9N2N6 | 200-643 | None |
| A0A410DSU0 | 5-514 | None |
| A0A7X8DAE8 | 449-982 | None |
| A0A1H4EL07 | 412-860 | None |
| E7QPH6 | 86-538 | None |
| A0A7H8LHC8 | 68-574 | None |
| A0A7W7RFH3 | 405-924 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.