DPCstruct | MC27306
Metacluster Properties and Pfam Annotations
| Number of structural domains | 87 |
|---|---|
| Mean domain length (aa) | 222 ± 29 aa |
| Standard deviation of domain lengths | 28.93 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 69.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0010- PF07213 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6Q653 | 133-317 | ACYWAAGPQYRLPESAGVVPCDENGYSACCKLGDICLAGNACYNFETDDTYQYGCSDPSYKDPSCPFKCDWNPDASPWVALEYCPSF… |
| A0A2J6SGJ5 | 1-191 | MTCYYPDGQPGEGLIPCNTTAAVSHCCRAGDLCVKNGYCFSTGLSALVRRGCTDQKFNGTVGCPQQCTIGDKFRGDVVLTPCDAPYI… |
| L7J4P2 | 8-267 | None |
| A0A420MT62 | 3-169 | None |
| A0A507BIY9 | 8-271 | None |
| A0A1B8AB49 | 13-227 | None |
| A0A2J6TRS7 | 2-182 | None |
| A0A2S4KZV1 | 10-198 | None |
| A0A3M7DDJ4 | 10-210 | None |
| Q2GYV0 | 18-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.