DPCstruct | MC27305
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 340 ± 39 aa |
| Standard deviation of domain lengths | 38.69 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01510 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q6BPF4 | 1-407 | MTGRVSGNATRHSSGRRRRHVLGRLGIRRRMWRDAAHLIRCGPPMKIRHWLAFPLLALSANCSAPDDSAHPREIGQLGQALFAAAHE… |
| A0A496VLT3 | 116-374 | TLRHFLEQAAQEFGVPVTILEAIAQVETNWTQIGPSIDRGWGIMHLVQNHYADTLGEAATRLNLDTQVLKDDARQNIRGAAALLAHY… |
| A0A3M1ZV58 | 1-349 | None |
| D2AU78 | 5-351 | None |
| A0A556N3S0 | 4-345 | None |
| A0A7W1EKZ4 | 1-324 | None |
| A0A7V5CLJ0 | 1-343 | None |
| A0A7W4Z7J3 | 47-356 | None |
| A0A2H9R2C5 | 312-669 | None |
| A0A520QUP1 | 1-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.