DPCstruct | MC27300
Metacluster Properties and Pfam Annotations
| Number of structural domains | 157 |
|---|---|
| Mean domain length (aa) | 397 ± 76 aa |
| Standard deviation of domain lengths | 76.38 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.12 |
| Pfam Score | 93.94 |
| Assigned Pfam label(s) | CL0714- CL0026 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2C4J1 | 9-372 | GWTFYYPFSAQSGSGVDFYMAAILLLGFSSLLGNANFIATIYNLRAQGMSLWKMPMYVWSVFAASLLNLFSLAGLTSASLLILLDRK… |
| A0A1G3BIF4 | 59-520 | TARNFIFSSVVWLGLVVSVALVLALKFVWPDFLGGVAWLSFGRLRPFHVNGALFGWLSMSSLGIMFYILPKLTGARLWSERLGNVTC… |
| A0A538IXA6 | 100-582 | None |
| A0A7C4GAJ0 | 34-501 | None |
| A0A800CGA1 | 2-290 | None |
| A0A349WG64 | 2-253 | None |
| A0A7C5Y474 | 3-330 | None |
| A0A2V8YVS7 | 2-299 | None |
| A0A7S0A5K4 | 106-641 | None |
| A0A350XPJ3 | 19-469 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.