DPCstruct | MC2730
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 154 ± 14 aa |
| Standard deviation of domain lengths | 14.17 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J1I404 | 1-169 | MWGALPATIILRNNDKTLNKETKNRYHQKLRLLTNVDIPTKERELEDPLEAIQKFNSCIDYLRQRTRDKAKYSLIFNENVSYGQARN… |
| A0A1C5NT92 | 55-209 | LPAQEFLLPSSRQIDIVTKERYYNFFSEHIDGFKTSNDDKEMLPYVSTAVTWLISKTRDSTKFPLIAEENANFGFTYNLLGLKPFGI… |
| A0A6I1EWB2 | 2-134 | None |
| A0A840D1S8 | 22-187 | None |
| A0A1W2GHL3 | 212-363 | None |
| A0A0P4UYI2 | 11-158 | None |
| A0A1V4I3H9 | 1-181 | None |
| A0A455V062 | 415-566 | None |
| A0A5J4RNC8 | 2-147 | None |
| A0A5P9XUE5 | 2-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.