DPCstruct | MC273
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 179 ± 16 aa |
| Standard deviation of domain lengths | 16.29 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 94.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645GWS4 | 31-219 | WTYQDTHHEVVFGAQTQELPNEQDAQEIADACRVSPENVYILAARTGSLTGSIQICSRTVEASIWRMERKGFNISKVISGTGTCPIA… |
| A0A832LKA5 | 68-257 | IGYRDEASEAILVLEASERPPEDAVRAIAEACHVSPERVSIIITPTSSIAGLTQISGRVVEAGMYKLVELGFEPRAVLYAWGCAPIP… |
| A0A0P0RM27 | 154-339 | None |
| A0A7C1K520 | 127-313 | None |
| A0A842QDC9 | 179-368 | None |
| A0A7C1MGJ2 | 3-190 | None |
| A0A3C1NDK2 | 532-719 | None |
| A0A497RSG3 | 118-277 | None |
| A0A832YVE5 | 1-152 | None |
| A0A6A7Y0P0 | 631-818 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.