DPCstruct | MC27294
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 147 ± 9 aa |
| Standard deviation of domain lengths | 9.13 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G3AC72 | 192-335 | LVSQLMGVYGHYRPEILKRWEYGGRSTLETFAPYASFVLRVELFYHIAAHKGRMSAAQRLDMTYMFYLPFCHVFVSKDRVHRNCAPF… |
| A0A317JIW5 | 11-167 | ATLKAKWEAEGRPDFKQFAQYANYCGRVFALYFLGVTAGLVLTGKKHKTLIDIVYFHYLPFVQIFCSGDKFHRDHFHYFAREDQRFI… |
| A0A2R7K4K8 | 64-199 | None |
| A0A841HVU9 | 174-328 | None |
| A0A161PUL4 | 192-327 | None |
| A0A522PTA3 | 115-265 | None |
| E8X848 | 1-150 | None |
| A0A836Q4G0 | 65-228 | None |
| A0A496AKD1 | 151-299 | None |
| A0A327QUL3 | 181-323 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.