DPCstruct | MC27291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 153 ± 43 aa |
| Standard deviation of domain lengths | 43.07 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 84.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02322 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R3INB5 | 14-194 | GRAYAGGNWDWLTPFSSLTALALLVGYAMLGATWLIVKTEGETLECASRFARPLGVALLVLIGAISLITPLQQPEYLLRWFGWPSGL… |
| A0A840IDQ1 | 153-336 | TGSFFDLLSPYALAGGAASLLLFTLHGAIFLTLRTSGEVAERAGRVAARLAAPALLVVAAFLAWTLALQDGVEWFSALLAAAAVVLG… |
| R6XTW9 | 66-292 | None |
| A0A1V2EY74 | 1-108 | None |
| C4V3Q3 | 20-141 | None |
| A0A7V5XHH1 | 1-82 | None |
| A0A378LQ48 | 593-785 | None |
| A0A7C5S559 | 2-105 | None |
| A0A6J5YJL5 | 5-122 | None |
| A0A378N7A5 | 51-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.