DPCstruct | MC27290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 192 |
|---|---|
| Mean domain length (aa) | 183 ± 29 aa |
| Standard deviation of domain lengths | 28.97 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 12.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0643 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496RM42 | 1-165 | MTNREKLRLLIGDKNKIMVNDQFGVGDGSNKYFQLSMYPVRATTEVIVLNNSSQTRDIDYTIDNDTGLITMTSAPSNGAILKAQKYE… |
| A0A661BX72 | 4-176 | IFRDKAKRRLGILETNLEFDSDIDDFTQEAVANLYPIIQAELEPEEFVLPANEYEISLADSDIVSVRKILIQNESGAWTSTDDYTMH… |
| A0A7X7II31 | 16-175 | None |
| A0A4Q2XYC8 | 31-164 | None |
| A0A3D4UST3 | 11-279 | None |
| A0A3N5FWG2 | 37-222 | None |
| A0A1C3K1H1 | 6-163 | None |
| A0A7W1C1Q7 | 107-332 | None |
| A0A0F9NTW1 | 204-383 | None |
| A0A7C7XSW4 | 834-1051 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.