DPCstruct | MC2729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 66 ± 7 aa |
| Standard deviation of domain lengths | 7.48 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A542ICJ0 | 9-72 | YLLEVRGDKPLQLREDLDKAVDKAIAHAVKIGRHGVLVTQYSYSYYTVALTEDVPYGQIQERRL |
| A0A024H2W3 | 11-83 | MKTIYPMTFTIASPHDLDQILDTAVEAAIEQATQRPAGAGILITRHNHRSFSLSFNQEVPYGTIMERDMRPSS |
| A0A0K2RU15 | 35-99 | None |
| A0A653YHT8 | 5-66 | None |
| A0A0K8QGQ7 | 2-52 | None |
| A0A7K1NGV2 | 5-69 | None |
| A0A7T8Z4H4 | 18-105 | None |
| A0A221R8H9 | 3-71 | None |
| A0JW67 | 3-72 | None |
| A0A4Q8UGC2 | 4-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.