DPCstruct | MC27284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 168 ± 32 aa |
| Standard deviation of domain lengths | 31.62 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04939 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H9TID6 | 12-145 | HLDVGNLAVFDINVLDDAVTSNNKVKREAGLLALTRDNTQLLINDLFVLPTTSTDVGAVASLPPPTTVLPRGKPVPKPKEPTRWEKF… |
| A0A074Z9Z4 | 334-485 | AEVDLGNLLFEDKAPLEFDSSGSVSDQHLRDIAKECTRHFFKLFWALPTEVVDNVTISKLPKPTFRLPREKRIPAVRDLTRWERFAK… |
| A0A7J6S8T4 | 204-420 | None |
| A0A6L5CLM9 | 24-225 | None |
| A0A0C2MGY3 | 13-194 | None |
| A0A099P0U3 | 10-193 | None |
| A0A7S2UUR0 | 178-374 | None |
| A0A0M3IEU9 | 21-197 | None |
| A0A830C3N4 | 86-283 | None |
| A0A0V0ZRP3 | 12-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.