DPCstruct | MC27283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 96 ± 4 aa |
| Standard deviation of domain lengths | 4.00 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 75.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 52.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A146MJ85 | 37-136 | MYHEVPTCHITTGYYVGFSFMMMRSYHNAVSALLATLSYKSRAIGLISQRADLKEYVNKQADQMMSLLAICVTMIPTSVDYNIDLDK… |
| A0A2U3E2G1 | 365-458 | VMAAHFTTYYYLGFSYMMMHRYADAIKMFSHILIYISRTKTYQKNPQYDSITKKNEQMYALIAICVAFQPTRLDDTIHSALREKYGD… |
| A0A2G9RPP9 | 138-228 | None |
| A0A0V0XVW1 | 289-379 | None |
| A0A2H1CPF7 | 44-144 | None |
| A0A6P7JTZ6 | 205-299 | None |
| H9H797 | 13-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.