DPCstruct | MC27282
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 79 ± 8 aa |
| Standard deviation of domain lengths | 8.04 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 26.88 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | PF00057- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S5FCI9 | 58-147 | TPLPPPPSPPTPAPFRPRIDLFPNEVTVRPMQYVRMECRVRNGYHPGTAMARPEIQLANGARMDTDPRFRVTRPSPDLLVVEIPLGL… |
| A0A3P6SM94 | 186-257 | MNCDFEVVISPGSIARRPRRPFEFTCSAPEGQRPVVRIVRDKTDVQYNPAFSVSRPKENAIIVRAPHGLTEA |
| A0A3S5ANR0 | 109-192 | None |
| A0A0R3XBN6 | 92-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.