DPCstruct | MC27280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 195 ± 35 aa |
| Standard deviation of domain lengths | 35.01 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 36.62 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | PF14926- CL0417 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A074Z2U9 | 43-250 | RLHARTFSFDENFKLYDHNIFIGCLLKSPGVVRALKEDGLAVPEYRQLLVEKVPCGSTEMTICSKIKALTARENGMIKKCYDDVIQS… |
| A0A6P3GBY6 | 128-352 | MLGRIEAQAFGFDQTFQAYRKDDFVMAFFKDPNVIPNLKLLSESSGEWLTLGTEVKKIEAINVPCTQLSMSFFNRLYDEAIVRDNGY… |
| A0A556UZD4 | 27-219 | None |
| A0A5K4EJ77 | 30-213 | None |
| A0A7R8ZDY4 | 4-178 | None |
| A0A7S0MZV7 | 5-146 | None |
| A0A4W3HR51 | 61-239 | None |
| R7TWN3 | 1-209 | None |
| A0A7S3Z9Y9 | 156-375 | None |
| A0A4W6D5I6 | 16-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.