DPCstruct | MC2728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 304 ± 66 aa |
| Standard deviation of domain lengths | 65.51 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 81.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D7ZQU9 | 37-327 | FVYTFSDFSLNVNSNQVTSWDESNFSPLQPLRVNRFIDTQKLTTLFDPITNSSVHFDYHLPYQQNEFWKTKGIFRPDQTLGSKNVQT… |
| A0A4R1BLT9 | 23-301 | NSETTPAYAHSYLLTGLLSSDYVDLTGNGITDDDLGDAVKFNYSKVRGFDNPYGWRAPYSEGASYNEGLKTYSRDDKANYIYGEKEL… |
| A0A0Q5ZT53 | 16-270 | None |
| A0A4Z1BBS2 | 11-334 | None |
| A0A086F2I1 | 125-443 | None |
| A0A086F366 | 3-243 | None |
| A0A0C1FVJ5 | 3-445 | None |
| A0A3G6ND02 | 118-344 | None |
| A0A1B9Y5R2 | 5-257 | None |
| A0A2R7N3I3 | 140-468 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.