DPCstruct | MC27279
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 118 ± 13 aa |
| Standard deviation of domain lengths | 13.27 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5K3D4 | 4-85 | TINIEARKPVWIALSEFYLDTELQGMDFRHIARIIMESPYSIEEVKEINKYEIFPVLQKNLTSVAGEWAGFQEECLVENILR |
| Q21PR8 | 1-128 | MLSNEEIDKRFPVWKAMSDLFLDTDLQESDYKFIANTVLKSGYSPREINSILWQEVLLGVGDNLRCIAGEWAGFNPVWLKHRMLDVL… |
| A0A5M3MEX2 | 9-128 | None |
| A0A560J923 | 34-166 | None |
| A0A553UR31 | 3-133 | None |
| A0A7H8PS88 | 14-134 | None |
| A0A7X1NU32 | 12-136 | None |
| A0A4Y7QBB5 | 3-118 | None |
| A0A6A5TH31 | 2-138 | None |
| A0A2N3T8T5 | 136-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.