DPCstruct | MC27274
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 108 ± 13 aa |
| Standard deviation of domain lengths | 12.82 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q5ZTX9 | 20-154 | NAKSTQQNITGFYKAEPLEEGGTSCDLSVLITKANGQYFYNLKINGKSRKGRVKITKGDKAGETYINFTGIKWAEYEGDVSKLGDDD… |
| A0A1Y5JR67 | 1-111 | MSSPEPSFVYYQSSVPTSCNLVVGLSQQHGQFEYKVTTDTRTVMGSFVKRGQQIIFSELYASKPAENSKIEVSALKQGDSLVIQNFG… |
| A0A7S9RER4 | 37-137 | None |
| A0A7C3Q8G1 | 375-497 | None |
| A0A519Y9N5 | 22-132 | None |
| A0A1G9SSY6 | 19-121 | None |
| A0A2T6EAR9 | 3-94 | None |
| A0A3P3WFS0 | 32-136 | None |
| A0A2G6ULD7 | 17-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.