DPCstruct | MC27265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 97 ± 8 aa |
| Standard deviation of domain lengths | 8.11 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y4R6I9 | 22-113 | QINEKTTVSKIVHDERFESYGQFIFPIERGYDESLTINHIDSLLPYHSHINTQTTIDVLNYMTDHHDSIFYDIYTDEEKSADPSKEN… |
| A0A5M9I355 | 2-95 | IHADTKVTDVIDNPLFAGYGRLIFPTAFGRPSASMTLDEVGSLLIYHNYVNTDTTIDVIREMEARRKQGEKIFYDIYTEQEKRRDPE… |
| A0A1C5NKZ8 | 2-94 | None |
| A0A4Y9GKB6 | 27-104 | None |
| A0A1C6G231 | 45-136 | None |
| A0A1R1BA86 | 63-164 | None |
| A0A0Q6RYS4 | 19-127 | None |
| F4H8T7 | 15-113 | None |
| A0A1T4LBD6 | 1-105 | None |
| R9M0G1 | 1-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.