DPCstruct | MC2726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 59 ± 6 aa |
| Standard deviation of domain lengths | 5.71 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 39.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05593 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H3ZED4 | 329-387 | HPESAQMVTATYTPLVGQTSSCNARGQVAYFEYDAANRLKLVKDQDGKILKLYDYQYRA |
| A0A7D7VS59 | 8-81 | TESDLRADLALLRDSFSGTAAQITTFTYDPLIGVTSITDPRGRTLYYHYDSFNRLQYVKDHDGNVLSEHSYNYK |
| A0A380BIG2 | 309-365 | None |
| U5C1C3 | 62-113 | None |
| A0A1K1S0K0 | 152-208 | None |
| A0A4Q1EXQ9 | 4-69 | None |
| A0A3C1BFU1 | 297-351 | None |
| A0A7D5MJ43 | 44-99 | None |
| A0A4R5DVF9 | 490-549 | None |
| A0A1V2B9W3 | 62-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.