DPCstruct | MC27255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 232 ± 29 aa |
| Standard deviation of domain lengths | 28.69 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818VRP5 | 1-248 | MKSAISSFKVTGLHNGITYFFTIVTIPETGPSQKTPQVIVTLSQRSGLQPRQLGLLINDNDPDSVILGEYYARRRNIPLENIVHLNI… |
| A0A4V0XFQ8 | 130-363 | AERVVVIYNPAAPGSEDVALAYADFRGVPAERLCPVTTTTEATLAGADYPAFVDSVFACATPWTEYIVPVWGVPYKVSDRVKDLAYD… |
| A0A136L8B8 | 215-465 | None |
| A0A3M1Q2M1 | 2-230 | None |
| A0A7X9PBA8 | 413-640 | None |
| A0A7S9CD73 | 96-356 | None |
| A0A497HT53 | 21-263 | None |
| A0A1M7QZJ6 | 356-635 | None |
| A0A4R3R7Q5 | 1-185 | None |
| A0A7C8DV14 | 92-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.