DPCstruct | MC27253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 98 ± 16 aa |
| Standard deviation of domain lengths | 15.68 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15636 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M4JSD5 | 52-167 | LQGKVETRTATRDEVAQLDWDRRFSNRRQRGVDRFWSDERKRLRGGEEGTRDWSPEQADDIIKNKRPKFDDKTIEGHHMYNALDYPQ… |
| A0A6A0BCX3 | 10-102 | EEKKKLNSERQKAVRDAWGKEKARVAQGEGTRDWSPEQQKEIMENGHADGYDGHHMKCVSSYPEQAGNPDNIQFLTHDEHIQGAHQG… |
| A0A3E2TXI9 | 81-173 | None |
| A0A416IEI9 | 4-102 | None |
| A0A5C8F778 | 413-509 | None |
| A0A182TR01 | 297-390 | None |
| A7GQ40 | 110-240 | None |
| A0A2A4K3X2 | 186-275 | None |
| A0A3A1QPH5 | 324-446 | None |
| A0A4Z2EQT6 | 188-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.