DPCstruct | MC2725
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 161 ± 12 aa |
| Standard deviation of domain lengths | 12.08 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D0LUT0 | 520-679 | LENYAAPVGAYRAKRTRPYTASISAMVGLAGGGELLDSAQDQGWHDHLGVFAPIGLDLACGEPNWCDGFGLLLSVIDVGNLATTRFT… |
| A0A7D7VLX3 | 18-182 | KKHVAPSVSFIHKKEYTSTISITSQPGYFVSTESIENNNGFVSGITLPIGFEFTWKVKKRPDPTKKIQNGSSIGIFAQLLDLGAMLN… |
| A0A7Y3TEJ6 | 654-811 | None |
| A0A538QIW3 | 6-178 | None |
| A0A6N8FDD8 | 418-569 | None |
| A0A2N2H4P7 | 15-187 | None |
| A0A2N2GL97 | 394-554 | None |
| A0A4Q1D7K1 | 153-321 | None |
| A0A7C5ISL0 | 256-424 | None |
| A0A227P572 | 707-867 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.