DPCstruct | MC27248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 108 ± 14 aa |
| Standard deviation of domain lengths | 13.74 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I5L7N6 | 49-153 | AEAFFDAAWTGVAVQLATDLRLKNDLLKRQGVEAALASVSSAVTLAPDATCIVVDKLQDDAIAAHDTGVTFVPSVFGRPHLVAIHAP… |
| A0A7H8HG18 | 2-133 | APEVRRIRPTGSAAASWLDDLGRGKPGALRHLRRSLHLYFKALVEPYLQVVDQGLRTECAAGIQRYLRTGPEGLLGRLGPDVHWQWP… |
| A0A397M2N1 | 43-135 | None |
| A0A1I5I078 | 2-136 | None |
| A0A1C4LCG5 | 77-183 | None |
| A0A853BXF0 | 2-99 | None |
| A0A3N1T193 | 2-99 | None |
| V6UG01 | 19-114 | None |
| A0A7U9PW20 | 70-177 | None |
| A0A1U9ZZF2 | 188-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.