DPCstruct | MC27247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 130 ± 13 aa |
| Standard deviation of domain lengths | 13.20 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 28.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A495CM03 | 118-249 | HLPTIGLPANGWFGVWFPAHTMWEHERKLSGWLGSDRSFRWDGHEGCWTVASAHFPRISRELLRRYPSVLIGREYNPRERCNSSCQN… |
| A0A7H8HDL4 | 116-245 | QAVSVLRPRDGRVQVTMPYSAGNRSWIREICGSRTRPVWNKAERRWEIARAHFRFIAEALADRFGACDVYLDIATRTVCTAACRDAR… |
| A0A4R8YI90 | 2-143 | None |
| A0A0U3NFW8 | 23-148 | None |
| A0A5J6IQI3 | 1-114 | None |
| A0A2A3YCV1 | 10-112 | None |
| A0A5C6UFN8 | 20-157 | None |
| V5BZ76 | 18-146 | None |
| A0A7Y6CRG8 | 3-143 | None |
| A0A1C5BKT1 | 89-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.