DPCstruct | MC27244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 270 ± 50 aa |
| Standard deviation of domain lengths | 50.11 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 20.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4DQJ2 | 46-315 | VGMKVWVHSTERKFISIGNIRYIGKVAFDERDAWVGIELDTANGRHDGTVAGKRYFTCARPNTGVFTRPKNIAVIPGYYRFLGVADI… |
| J9D4G4 | 2-298 | CFKVGDKIKMRKNTGFIRYIGEILEKEGQWIGIELEDDCGKNDGTWNGVRYFDTKGRQSGIFIKYDKFVSALERSTSENVNINAQNE… |
| A0A0S6XB21 | 6-404 | None |
| A0A177BA24 | 89-363 | None |
| A0A2B4RAL2 | 333-554 | None |
| A0A1G4JW22 | 8-247 | None |
| A2FDP4 | 3-298 | None |
| I2GWL9 | 10-308 | None |
| A0A099P1U6 | 2-325 | None |
| A0A1G4MGR6 | 8-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.