DPCstruct | MC27241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 7.83 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0728 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q32CH6 | 23-112 | MSMLVVVTENVPPRLRGRLAIWLLEVRAGVYVGDVSAKIREMIWEQIAGLAEEGNVVMAWATNTESGFEFQTFGVNRRTPVDLDGLR… |
| A0A2X1M5G5 | 2-74 | SMLVVVTENVPPRLRGRLAIWLLEVRAGVYVGVVSARIREMIWEQISGLAEEGNVVMAWATNTESGFEFQTFG |
| A0A842W3H9 | 2-92 | None |
| F8XMT8 | 2-89 | None |
| A0A7V2YW68 | 2-88 | None |
| A0A7K1LIY1 | 2-90 | None |
| A0A2S7FLJ5 | 2-76 | None |
| A0A644YRV2 | 1-76 | None |
| A0A3L7NAI8 | 63-136 | None |
| A0A248YPA4 | 1-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.