DPCstruct | MC2724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 190 ± 54 aa |
| Standard deviation of domain lengths | 53.63 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 87.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W6CN82 | 160-389 | AAVAATRSGFLTGVNAEALCAAAVTADAMIVIDPHPGDAIVAGTPIGWIWSRTHEDLSADVLERLTGAVESGVSVGFERTSTQDVGF… |
| A0A7C7NYT8 | 49-247 | GVFLDFAKENDCKFEIVSIKGNFVFKDEILFKCNKELGEEQLEEVHSFFSFSSSQRIEDNYVLAFKQMTEIAVKSMSPGINDPGTAL… |
| A0A4Q0P8P7 | 49-254 | None |
| A0A3G8XV20 | 78-289 | None |
| A0A5J4YGR0 | 355-594 | None |
| A0A2T2RVP3 | 14-171 | None |
| A0A411YAW2 | 549-797 | None |
| S4MZU6 | 2-128 | None |
| A0A109S754 | 50-236 | None |
| A0A7Z7I798 | 11-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.