DPCstruct | MC27238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 487 ± 58 aa |
| Standard deviation of domain lengths | 58.24 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 55.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0233- PF02445 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D9XYP5 | 6-380 | DSDSELSRGYCACLVSALDGARPEEVLGVDPADLAPLSTPGAGSRASTWHNVLVGMQKRARAAIAAHEGRPPGEPFPSLVIGRDGAV… |
| D8U8Q3 | 1-549 | MDARMHRRELQAQLSVPPVRATLAEVRGCDSDPVEGVPTALEALLGRLTATDDAKERMRWMIGERRLLELGAALEPLSADQRKGENR… |
| A0A383W510 | 48-488 | None |
| A0A5B8MZH6 | 3-497 | None |
| A0A6I9RPR4 | 1-403 | None |
| A0A0E0J955 | 3-551 | None |
| A0A6A6K201 | 1-527 | None |
| A0A7S0VII0 | 1-557 | None |
| A0A453K433 | 1-460 | None |
| A0A2P6TPP4 | 3-512 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.