DPCstruct | MC27233
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 117 ± 24 aa |
| Standard deviation of domain lengths | 24.39 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 42.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C1W061 | 92-208 | MKQFVKALRQDSEAFQYLKSFFPKLSEAKIKAGIFIGPQIKKIMASEQFLRLLSTHEKQAWLSLKAVIHGFLGNRKAENYTELITDM… |
| A0A4Y2DTE0 | 16-141 | KIFVKALDREGVAFLHLGNKFKHLSDAKVKEGMLIGPQIKAVFRDEEFEKKLSGAEKAAWLAFKSVCTHFLGNKKAENYEDLVGDMV… |
| A0A6P4LE67 | 65-147 | None |
| A0A4Y2T2M3 | 90-211 | None |
| A0A4Y2A6Y3 | 145-283 | None |
| A0A4C1UC60 | 19-135 | None |
| A0A4Y2CZS0 | 1-90 | None |
| A0A4Y2CSS9 | 178-292 | None |
| A0A4Y2UEI9 | 31-157 | None |
| A0A7T8QVG0 | 113-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.