DPCstruct | MC27231
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 292 ± 65 aa |
| Standard deviation of domain lengths | 64.96 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H9JK96 | 1-195 | MPSVYTFSRSDNEILQELLKVFNTARGTAREQWSIQAELLVEPVGWDALWKLSKEFCKKFEVRYPCIAYVTVTSVDFENLSSSVDVL… |
| A0A5E4QI68 | 1-194 | MPAAYPFNKSDNEILRDLLLMFSSSQGTAKEQWSILTETLINQVGWDALWKLSKEFCKKFDERYPCVVFVSVTSVNSEELSANVEVL… |
| A0A6B0REG8 | 1-295 | None |
| A0A674JJM6 | 1-306 | None |
| A0A4U1EH75 | 226-449 | None |
| U4TY03 | 3-299 | None |
| A0A4Z2BEM5 | 4-239 | None |
| A0A2J8N6M2 | 74-309 | None |
| A0A1S3IF38 | 421-685 | None |
| A0A7M7N6X4 | 53-403 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.