DPCstruct | MC2723
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 84 ± 10 aa |
| Standard deviation of domain lengths | 10.30 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9ESK5 | 1-70 | KYPLFTLKAAGLSPLGSLGNYQEASLLRLDMGTNYQYWYGLPNFYTITRYNHSVHYAMAVWQLGQAVKAA |
| A0A485ICQ9 | 64-147 | ESAVTRGVDPTMSLGELRARGWRTHDALRDDQKVTAMRFVGDKGIEYWVGLPNFYVITRYNRSAMYAMAVYQLAGEIARARGAH |
| A0A7C2PGB9 | 1-88 | None |
| A0A4Q3NP98 | 112-187 | None |
| A0A5M8FJ88 | 288-390 | None |
| A0A455VEF2 | 78-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.