DPCstruct | MC27227
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 78 ± 13 aa |
| Standard deviation of domain lengths | 12.60 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 77.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2DI13 | 1-87 | MRSAASIGQQVSDKAVGLVPAAKMAGYQDLSNFERGLIVGAREMRHSISEVAMKFGYSHTTISRVYHEYRVSGKTSKLEHRRDQKRP |
| A0A4Y2EGY1 | 1-62 | MAGYQDLSKFERGVIVGAREMGHSISEVAIKFGFSRTAISRMYREYRESGRTSNLRHRCGRK |
| A0A4Y2BBL1 | 1-81 | None |
| A0A4Y2VQX6 | 1-100 | None |
| A0A4Y2VAI9 | 89-177 | None |
| A0A4Y2CZN9 | 1-63 | None |
| A0A4Y2B0P5 | 139-207 | None |
| A0A4Y2DRJ3 | 4-66 | None |
| A0A4Y2FPI0 | 63-145 | None |
| A0A4Y2GUL8 | 9-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.