DPCstruct | MC27226
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 143 ± 9 aa |
| Standard deviation of domain lengths | 9.48 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653BEV1 | 148-293 | FCPTMEVKVTEDGTRVASILCGLGFNKYTKKALYPAHDLVLMLDTELTEEEITKVNGIRFYMNQGVNLMQEISNRMSSQEEMITTQQ… |
| A0A4Y2D996 | 29-169 | WTFGTDRAQKSYIGALCGLGYDPITKESLYPDHDIELAFDIELNIEDIREINAIRMGFNLLLHSDCDALQYQTNPVSVVHEQTRKTI… |
| A0A194PG08 | 26-171 | None |
| L9KDV7 | 6-152 | None |
| R7U7W0 | 140-289 | None |
| A0A819MH27 | 123-246 | None |
| A0A7R9PTD6 | 53-198 | None |
| A0A813W535 | 307-457 | None |
| A0A5E4CD28 | 26-171 | None |
| A0A485NN40 | 517-663 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.