DPCstruct | MC27220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 263 ± 27 aa |
| Standard deviation of domain lengths | 26.62 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 19.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A428P9C8 | 178-455 | MSLRRSVDSHGIPDGPWKADASEIEAVLSLWLWSMGEPVKSHDKEDPDIKAVEPRINRILSFHSHAEDRDDDFDGDMQLSLWYKRAT… |
| A0A3M2RIU7 | 1-284 | MSLRRSVDSHGIPDGPWKADTSDIEAVLSLWLWSMEEPTKAYDEEDPDIKTVEPRINRILSVHSDTAHTDAADRDDDIHEAMQLSLW… |
| A0A6A6JXX8 | 114-396 | None |
| A0A4V1XMJ3 | 457-723 | None |
| A0A4Q4X0P1 | 596-894 | None |
| A0A2T2NS81 | 87-316 | None |
| A0A8A3PLY2 | 3-222 | None |
| A0A6C1M7D0 | 302-547 | None |
| A0A135U071 | 29-266 | None |
| A0A4E9DUT3 | 329-582 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.